ProTx-II (0.1mg vial)
Product Name: ProTx-II (0.1mg vial)
Product Number: PTX-4450-s
Synonym(s): Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Leu-Trp; ProTx2, ProTx-2
One-Letter-Code: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW
Disulfide Bonds: (Disulfide Bonds between Cys2- Cys16, Cys9- Cys21, and Cys15- Cys25)
Application: Na+ Channel (Especially Nav1.7) / Ca2+ Ion Channel Blocker (Gating Modifier)
Description: A spider venom-peptide whose sequence is derived from the Tarantula, Thrixopelma pruriens.
Source: Thrixopelma pruriens
Molecular Weight (g/mol): 3826.6
Storage Conditions: -20 °C
Reference(s): R.E. Middleton, V.A. Warren, R.L. Kraus, J.C. Hwang, C.J. Liu, G. Dai, R.M. Brochu, M.G. Kohler, Y.-D. Gao, V.M. Garsky, M.J. Bogusky, J.T. Mehl, C.J. Cohen, and M.M. Smith, Biochemistry, 41,14734 (2002).(Original) J.J. Smith, T.R. Cummins, S. Alphy, and K.M. Blumenthal, J. Biol. Chem., 282, 12687 (2007). (Pharmacol.; Novel Toxin Binding Site Coupled to NaV Activation) B.T. Priest, K.M. Blumenthal, J.J. Smith, V.A. Warren, and M.M. Smith, Toxicon, 49,194 (2007). (Review)
Special Note(s): For research use ONLY. Not for use on humans.