Soybean BBI
Product Name: Soybean BBI
Product Number: AA-0017
One-Letter-Code: DDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDKEN
Application: Bowman-Birk Soybean Inhibitor
Description: Manufactured by AmideBio, LLC.; May require additional lead time, please inquire. Unit definition: One trypsin unit will produce a ΔA253 of 0.001 per min with BAEE as substrate at pH 7.6 at 25 °C; reaction volume 3.2 ml, 1 cm light path.M.W.: 7.8 kDaThe Bowman-Birk inhibitor (BBI) from soybean is a monomeric protein containing 71 amino acids in a single polypeptide chain crosslinked by seven disulfide bridges. This inhibitor contains two independent inhibitory binding sites, one for trypsin and the other for chymotrypsin. BBI binds each protease to form a 1:1 complex. Since the inhibition is non-competitive, BBI has the ability to form a ternary complex with both enzymes.Specific Activity: One mg protein will inhibit ≥2 mg trypsin with activity of ~10,000 BAEE units per mg protein.One mg protein will inhibit ≥2.0 mg chymotrypsin with activity of ~40 BTEE units per mg protein.Solubility: Trypsin-chymotrypsin inhibitor is soluble in water or 0.67M Sodium phosphate, pH 7.6 (1 mg/ml).
CAS Number: 37330-34-0
Molecular Weight (g/mol): 7872
Purity: > 99% HPLC, Mass spec
Storage Conditions: -20 °C
Special Note(s): For research use ONLY. Not for use on humans.