Amyloid beta (1-40)
Product Name: Amyloid beta (1-40)
Product Number: AA-002
Synonym(s): Abeta (1-40); Abeta
One-Letter-Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Description: Manufactured by AmideBio, LLC.; May require additional lead time, please inquire. Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. Lyophylized.; ;
Molecular Weight (g/mol): 4329.9
Purity: > 99% HPLC, Mass spec
Storage Conditions: -20 °C
Special Note(s): For research use ONLY. Not for use on humans.