Amyloid beta (1-40)

Product Name: Amyloid beta (1-40)

Product Number: AA-002

Synonym(s): Abeta (1-40); Abeta

One-Letter-Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Description: Manufactured by AmideBio, LLC.; May require additional lead time, please inquire. Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. Lyophylized.; ;

Molecular Weight (g/mol): 4329.9

Purity: > 99% HPLC, Mass spec

Storage Conditions: -20 °C

Special Note(s): For research use ONLY. Not for use on humans.