Amyloid beta (42-1)
Product Name: Amyloid beta (42-1)
Product Number: AA-003
One-Letter-Code: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Description: Manufactured by AmideBio, LLC.; May require additional lead time, please inquire. Beta amyloid (42-1) is the reverse of beta amyloid (1-42) and is used as a control peptide. Beta amyloid (1-42) is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer’s disease (AD) brain. Lyophylized.
Molecular Weight (g/mol): 4514.1
Purity: > 99% HPLC, Mass spec
Storage Conditions: -20 °C
Special Note(s): For research use ONLY. Not for use on humans.