Amyloid beta (42- 1) SCR

Product Name: Amyloid beta (42- 1) SCR

Product Number: AA-004

Synonym(s): Scrambled amyloid beta peptide

One-Letter-Code: KVKGLIDGDHIGDLVYEFMDSNSAIFREGVGAGHVHVAQVEF

Application: Control Peptide

Description: Manufactured by AmideBio, LLC.; May require additional lead time, please inquire. Scrambled amyloid β peptide (1-42) is amyloid β (1-42) with scrambled sequence. It therefore has the same amino acid composition but different sequence and is often used as a control peptide. Beta amyloid (1-42) is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer’s disease (AD) brain.

Molecular Weight (g/mol): 4514.1

Purity: > 99% HPLC, Mass spec

Storage Conditions: -20 °C

Special Note(s): For research use ONLY. Not for use on humans.