Amyloid beta (40-1)
Product Name: Amyloid beta (40-1)
Product Number: AA-005
Synonym(s): Abeta (40-1); Abeta
One-Letter-Code: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Application: Control Peptide
Description: Manufactured by AmideBio, LLC.; May require additional lead time, please inquire. A reversed, inactive sequence of the Amyloid β peptide (1-40) commonly used as a control peptide. Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. Lyophylized.;
Purity: > 99% HPLC, Mass spec
Storage Conditions: -20 °C
Special Note(s): For research use ONLY. Not for use on humans.