Product Name: Der P1

Product No: ALR-003

Synonym(s): Der P1 Protein Recombinant, Peptidase 1, Major mite fecal allergen Der p 1, Allergen Der p I, Der p 1, DERP1, Der-P1.

One-Letter-Code: MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY VVILHHHHHH.

Description: The E.Coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a.a. 20-320) and fused to a 6 His Tag at C-terminus, having a total Mw of 34.5kDa, pI 5.6.

Protein Derived From: Escherichia Coli.

Purity: Protein is >95% pure as determined by 10% SDS-PAGE (coomassie staining).

Stability: Der-P1 although stable at 4C for 1 week, should be stored below -18C.Please prevent freeze thaw cycles.

Purification Method: Purified by proprietary chromatographic technique.

Special Note(s): Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.