Snakin-1 (0.1mg vial)

Product Name: Snakin-1 (0.1mg vial)

Product Number: AMP-4503-s

Synonym(s): SN1, GSL1, Gly-Ser-Asn-Phe-Cys-Asp-Ser-Lys-Cys-Lys-Leu-Arg-Cys-Ser-Lys-Ala-Gly-Leu-Ala-Asp-Arg-Cys-Leu-Lys-Tyr-Cys-Gly-Ile-Cys-Cys-Glu-Glu-Cys-Lys-Cys-Val-Pro-Ser-Gly-Thr-Tyr-Gly-Asn-Lys-His-Glu-Cys-Pro-Cys-Tyr-Arg-Asp-Lys-Lys-Asn-Ser-Lys-Gly-Lys-Ser-Lys-Cys-Pro

One-Letter-Code: GSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP

Disulfide Bonds: Disulfide bonds between Cys5-Cys30, Cys9-Cys26, Cys13-Cys22, Cys29-Cys62, Cys33-Cys49 and Cys35-Cys47

Application: Antimicrobial Peptide

Description: Antimicrobial Peptide that originated from the potato

Source: Solanum tuberosum

CAS Number: 1427832-11-8

Purity: ?90.0% (HPLC)

Storage Conditions: -20 °C

Reference(s): A. Segura, M. Moreno, F. Madueno, A. Molina, and F. Garcia-Olmedo, Mol. Plant-Microbe Interact., 12, 16 (1999). (Original) P.W.R. Harris, S.-H. Yang, A. Molina, G. Lopez, M. Middleditch, and M.A. Brimble, Chem. Eur. J., 20, 5102 (2014). (Chem. Syntesis) H. Yeung, C.J. Squire, Y. Yosaatmadja, S. Panjikar, G. Lopez, A. Molina, E.N. Baker, P.W. Harris, and M.A. Brimble, Angew. Chem. Int. Ed., 55, 7930 (2016). (S-S Bond) M.R. Kuddus, F. Rumi, M. Tsutsumi, R. Takahashi, M. Yamano, M. Kamiya, T. Kikukawa, M. Demura, and T. Aizawa, Protein Expr. Purif., 122, 15 (2016). (Rec. Synthesis) H. Senechal, J. Santrucek, M. Melcova, P. Svoboda, J. Zidkova, D. Charpin, L. Guilloux, Y. Shahali, M.A. Selva, R. Couderc, T. Aizawa, and P. Poncet, J. Allergy Clin. Immunol., 141, 411 (2018). (Pharmacol.) T. Wu etal., Citrus. Plant Growth Regul,; (2020). https://doi.org/10.1007/s10725-020-00589-1

Special Note(s): For research use ONLY. Not for use on humans.