APETx2 (0.1 mg vial)

Product Name: APETx2 (0.1 mg vial)

Product Number: APE-4472-s

Synonym(s): Gly-Thr-Ala-Cys-Ser-Cys-Gly-Asn-Ser-Lys-Gly-Ile-Tyr-Trp-Phe-Tyr-Arg-Pro-Ser-Cys-Pro-Thr-Asp-Arg-Gly-Tyr-Thr-Gly-Ser-Cys-Arg-Tyr-Phe-Leu-Gly-Thr-Cys-Cys-Thr-Pro-Ala-Asp

One-Letter-Code: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD

Disulfide Bonds: Reported Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38

Application: Selective Blocker of Acid-Sensing Ion Channel, ASIC3

Description: A synthetic sea anenome toxin

Source: Sea Anemone, Anthopleura elegantissima (Synthetic Product)

CAS Number: 713544-47-9

Molecular Weight (g/mol): 4561

Purity: ?99.0% (HPLC)

Storage Conditions: -20 °C

Reference(s): S. Diochot, A. Baron, L.D. Rash, E. Deval, P. Escoubas, S. Scarzello, M. Salinas, and M. Lazdunski, EMBO J., 23, 1516 (2004). (Original ; Primary Structure, S-S Bond & Pharmacol.) B. Chagot, P. Escoubas, S. Diochot, C. Bernard, M. Lazdunski, and H. Darbon, Protein Sci., 14, 2003 (2005). (NMR Structure) S. Diochot, M. Salinas, A. Baron, P. Escoubas, and M. Lazdunski, Toxicon, 49, 271 (2007). (Pharmacol.) E. Deval, J. Noël, N. Lay, A. Alloui, S. Diochot, V. Friend, M. Jodar, M. Lazdunski, and E. Lingueglia, EMBO J., 27, 3047 (2008). (Pharmacol.) J. Karczewski, R.H. Spencer, V.M. Garsky, A. Liang, M.D. Leitl, M.J. Cato, S.P. Cook, S. Kane and M.O. Urban, Br. J. Pharmacol., 16, 950 (2010). (Pharmacol.) E. Deval, J. Noël, X. Gasull, A. Delaunay, A. Alloui, V. Friend, A. Eschalier, M. Lazdunski, and E. Lingueglia, J. Neurosci., 31, 6059 (2011). (Pharmacol.) W.-L. Wu, C.-F. Cheng, W.-H. Sun, C.-W. Wong, and C.-C. Chen, Pharmacol. Ther., 134, 127 (2012). (Review; Pharmacol.)

Special Note(s): For research use ONLY. Not for use on humans.