APETx2 (0.1 mg vial)
Product Name: APETx2 (0.1 mg vial)
Product Number: APE-4472-s
Synonym(s): Gly-Thr-Ala-Cys-Ser-Cys-Gly-Asn-Ser-Lys-Gly-Ile-Tyr-Trp-Phe-Tyr-Arg-Pro-Ser-Cys-Pro-Thr-Asp-Arg-Gly-Tyr-Thr-Gly-Ser-Cys-Arg-Tyr-Phe-Leu-Gly-Thr-Cys-Cys-Thr-Pro-Ala-Asp
One-Letter-Code: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD
Disulfide Bonds: Reported Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38
Application: Selective Blocker of Acid-Sensing Ion Channel, ASIC3
Description: A synthetic sea anenome toxin
Source: Sea Anemone, Anthopleura elegantissima (Synthetic Product)
CAS Number: 713544-47-9
Molecular Weight (g/mol): 4561
Purity: ?99.0% (HPLC)
Storage Conditions: -20 °C
Reference(s): S. Diochot, A. Baron, L.D. Rash, E. Deval, P. Escoubas, S. Scarzello, M. Salinas, and M. Lazdunski, EMBO J., 23, 1516 (2004). (Original ; Primary Structure, S-S Bond & Pharmacol.) B. Chagot, P. Escoubas, S. Diochot, C. Bernard, M. Lazdunski, and H. Darbon, Protein Sci., 14, 2003 (2005). (NMR Structure) S. Diochot, M. Salinas, A. Baron, P. Escoubas, and M. Lazdunski, Toxicon, 49, 271 (2007). (Pharmacol.) E. Deval, J. Noël, N. Lay, A. Alloui, S. Diochot, V. Friend, M. Jodar, M. Lazdunski, and E. Lingueglia, EMBO J., 27, 3047 (2008). (Pharmacol.) J. Karczewski, R.H. Spencer, V.M. Garsky, A. Liang, M.D. Leitl, M.J. Cato, S.P. Cook, S. Kane and M.O. Urban, Br. J. Pharmacol., 16, 950 (2010). (Pharmacol.) E. Deval, J. Noël, X. Gasull, A. Delaunay, A. Alloui, V. Friend, A. Eschalier, M. Lazdunski, and E. Lingueglia, J. Neurosci., 31, 6059 (2011). (Pharmacol.) W.-L. Wu, C.-F. Cheng, W.-H. Sun, C.-W. Wong, and C.-C. Chen, Pharmacol. Ther., 134, 127 (2012). (Review; Pharmacol.)
Special Note(s): For research use ONLY. Not for use on humans.