APP, A4, AD1 MS Calibrator

Product Name: APP, A4, AD1 MS Calibrator

Product No: BP22-746

Protein Name: Amyloid beta A4 Protein; ABPP; APPI; Short=APP; Alzheimer Disease Amyloid Protein; Amyloid Precursor Protein; Beta-Amyloid Precursor Protein; Cerebral Vascular Amyloid Peptide; Short=CVAP; PreA4; Protease Nexin-II; Short=PN-II; Contains: N-APP;

One-Letter-Code: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH

Uniprot ID: P05067

Application: High quality, quantitated heavy/light peptide calibrator for Mass Spectroscopy research

Storage Conditions: -20°C

Special Note(s): For research use ONLY. Not for use on humans.