IP 10 Human
Product Name: IP 10 Human
Product No: CHM-330
Synonym(s): IP-10 Human Recombinant (CXCL10), Small inducible cytokine B10, CXCL10, 10 kDa, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10.
One-Letter-Code: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP.
Description: IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.
Protein Derived From: Escherichia Coli.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Stability: Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Solubility: It is recommended to reconstitute the lyophilized IP-10 in sterile 18MOmega-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Special Note(s): Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.