ProNGF Human

Product Name: ProNGF Human

Product No: CYT-426

Synonym(s): Pro-Nerve Growth Factor Human Recombinant, Human Pro-NGF, ProNGF, NGFB.

One-Letter-Code: MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.

Description: Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.

Protein Derived From: Escherichia Coli.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Purity: Greater than 95.0% as determined by SDS-PAGE.

Stability: Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

References: Title: ProNGF inhibits NGFmediated TrkA activation in PC12 cells. Publication: Journal of neurochemistry107.5 (2008): 1294-1303. Link:http://onlinelibrary.wiley.com/doi/10.1111/j.1471-4159.2008.05690.x/epdf

Special Note(s): ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.