Product Name: Echistatin

Product Number: ECT-3760-PI

Synonym(s): H-Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Cys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr-OH

One-Letter-Code: H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGCTCDCPRNPHKGPAT-OH

Disulfide Bonds: Cys2-Cys11, Cys7-Cys32, Cys8-Cys37, and Cys20-Cys39

Application: alphaVbeta3 Integrin Antagonist

Description: A disintegrin, whose sequence is derived from the venom of the viper, Echis carinatus.; This snake venom is an inhibitor of both integrin-dependent cell adhesion and platelet aggregation, preventing blood coagulation. Echistatin also contains the Arg-Gly-Asp (RGD) sequence.

Salt Form: Trifluoroacetate Salt

CAS Number: 154303-05-6

Molecular Weight (g/mol): 5417.14

Storage Conditions: -20 °C

Reference(s): J. Musial, et al., Circulation, 82, 261 (1990). M. Sato, et al., J. Cell.Biol., 111, 1713 (1990). C.C. Kumar, et al., J. Pharmacol.Exp.Ther., 283, 843 (1997). V. Garsky, et al., Proc Nat Acad of Sciences, 86, 4022 (1989).

Special Note(s): For research use ONLY. Not for use on humans.