Product Name: HBeAg

Product No: HBV-272

Synonym(s): Hepatitis B Virus e-Antigen Recombinant

One-Letter-Code: MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNL EDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVV

Description: Recombinant hepatitis B virus “e” antigen VLP (virus like particle)produced in E.coli, is a 149a.a protein and having a molecular mass of approximately 18kDa. The HBeAg sequence is derived from HBV adw2 and fused to 6xHis Tag at C-terminus.

Protein Derived From: Escherichia Coli.

Purity: Protein is >95% pure as determined by 12% PAGE (coomassie staining).

Stability: HBeAg although stable at 4C for 1 week, should be stored below -18C.Please prevent freeze thaw cycles.

Purification Method: Purified by proprietary chromatographic technique.

Special Note(s): ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.