Amyloid beta-Protein (Human, 1-43) (0.5 mg vial)

Product Name: Amyloid beta-Protein (Human, 1-43) (0.5 mg vial)

Product Number: PAB-4370-v

Synonym(s): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr

One-Letter-Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAYY

Application: Major Plaque Component in Alzheimer's Disease

Salt Form: Trifluoroacetate Salt

CAS Number: 134500-80-4

Molecular Weight (g/mol): 4615.1

Storage Conditions: -20 °C

Reference(s): A. Tamaoka, T. Kondo, A. Odaka, N. Sahara, N. Sawamura, K. Ozawa, N. Suzuki, S. Shoji, and H. Mori, Biochem. Biophys. Res. Commun., 205, 834 (1994). (Pharmacol.) K. Hsiao, P. Chapman, S. Nilsen, C. Eckman, Y. Harigaya, S. Younkin, F. Yang, and G. Cole, Science, 274, 99 (1996). (Pharmacol.) K. Duff, C. Eckman, C. Zehr, X. Yu, C.-M. Prada, J. Perez-tur, M. Hutton, L. Buee, Y. Harigaya, D. Yager, D. Morgan, M.N. Gordon, L. Holcomb, L. Refolo, B. Zenk, J. Hardy, and S. Younkin, Nature, 383, 710 (1996). (Pharmacol.) T. Kawarabayashi, Y. Igeta, M. Sato, A. Sasaki, E. Matsubara, M. Kanai, Y. Tomidokoro, K. Ishiguro, K. Okamoto, S. Hirai, and M. Shoji, Brain. Res., 765, 343 (1997). (Pharmacol.)

Special Note(s): For research use ONLY. Not for use on humans.