Amyloid beta-Protein (Human, 1-40) (HCl Form) (0.5 mg vial)

Product Name: Amyloid beta-Protein (Human, 1-40) (HCl Form) (0.5 mg vial)

Product Number: PAB-4379-v

Synonym(s): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

One-Letter-Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Application: Specific Form Easily Transferrable to beta-Structure

Salt Form: (Hydrochloride Form)

CAS Number: 131438-79-4

Molecular Weight (g/mol): 4329.89

Storage Conditions: -20 °C

Reference(s): I. Kaneko, N. Yamada, Y. Sakuraba, M. Kamenosono, and S. Tutumi, J. Neurochem., 65, 2585 (1995). (Original) I. Kaneko, S. Tutumi, J. Neurochem., 68, 438 (1997). (Facile β-Structure Formation)

Special Note(s): For research use ONLY. Not for use on humans.