Amyloid beta-Protein (40-1) (0.1mg vial)

Product Name: Amyloid beta-Protein (40-1) (0.1mg vial)

Product Number: PAB-4413-s

Synonym(s): Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp, Peptide with Reversed Sequence of Amyloid beta-Protein

One-Letter-Code: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Application: Peptide with Reversed Sequence of Amyloid beta-Protein

Salt Form: Trifluoroacetate Salt

CAS Number: 144409-99-4

Molecular Weight (g/mol): 4329.8

Storage Conditions: -20 °C

Special Note(s): For research use ONLY. Not for use on humans.