Amyloid beta-Protein (Human, 1-40) (TFA Form) (0.5 mg vial)

Product Name: Amyloid beta-Protein (Human, 1-40) (TFA Form) (0.5 mg vial)

Product Number: PAM-4307-v

Synonym(s): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

One-Letter-Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Application: Peptide Deposited in the Brain of Alzheimer's Disease Patient

Salt Form: Trifluoroacetate Salt

CAS Number: 131438-79-4

Molecular Weight (g/mol): 4329.8

Storage Conditions: -20 °C

Reference(s): B.A. Yankner, L.K. Duffy, and D.A. Kirschner, Science, 250, 279 (1990). (Original)

Special Note(s): For research use ONLY. Not for use on humans.