Agouti-Related Protein (Human, 86-132) (0.1mg vial)

Product Name: Agouti-Related Protein (Human, 86-132) (0.1mg vial)

Product Number: PAR-4366-s

Synonym(s): Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr; AGRP (Human, 86-132)

One-Letter-Code: RCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Disulfide Bonds: (Disulfide bonds between Cys87-Cys102, Cys94-Cys108, Cys101-Cys119, Cys105-Cys129, and Cys110-Cys117)

Application: Melanocortin Receptor-3/4 Antagonist; Appetite Boosting Peptide

Description: Potent inhibitor of melanocortin receptor function

Molecular Weight (g/mol): 5347.2

Storage Conditions: -20 °C

Reference(s): R.D. Rosenfeld, L. Zeni, A.A. Welcher, L.O. Narhi, C. Hale, J. Marasco, J. Delaney, T. Gleason, J.S. Philo, V. Katta, J. Hui, H. Baumgartner, M. Graham, K.L. Stark, and W. Karbon, Biochemistry, 37, 16041 (1998). (Original) E.J. Bures, J.O. Hui, Y. Young, D.T. Chow, V. Katta, M.F. Rohde, L. Zeni, R.D. Rosenfeld, K.L. Stark, and M. Haniu, Biochemistry, 37, 12172 (1998). (Structure; S-S Bond) J.R. Shutter, M. Graham, A.C. Kinsey, S. Scully, R. Lüthy, and K.L. Stark, Genes Dev., 11, 593 (1997). (Agouti-Related Transcript Sequence) D.M. Diinulescu and R.D. Con, J. Bio.. Chem., 275, 6695 (2000). (Review). T.R.H. Buch et al., JBC, 284 (39), 26411 (2009).

Special Note(s): For research use ONLY. Not for use on humans.