BNP-32 (Human) (0.5 mg vial)
Product Name: BNP-32 (Human) (0.5 mg vial)
Product Number: PBN-4212-v
Synonym(s): B-Type (Brain) Natriuretic Peptide-32 (Human); Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His; BNP; Nesiritide
One-Letter-Code: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Disulfide Bonds: Cys10-Cys26
CAS Number: 124584-08-3
Molecular Weight (g/mol): 3464
Storage Conditions: -20 °C
Reference(s): T. Sudoh, K. Maekawa, M. Kojima, N. Minamino, K. Kangawa, and H. Matsuo, Biochem. Biophys. Res. Commun., 159, 1427 (1989). (Original; cDNA) Y. Kambayashi, K. Nakao, M. Mukoyama, Y. Saito, Y. Ogawa, S. Shiono, K. Inouye, N. Yoshida, and H. Imura, FEBS Lett., 259, 341 (1990). (Original; Isolation and Structure) A. Rosenzweig and C.E. Seidman, Annu. Rev. Biochem., 60, 229 (1991). (Review)
Special Note(s): For research use ONLY. Not for use on humans.