SNX-482 (0.1mg vial)

Product Name: SNX-482 (0.1mg vial)

Product Number: PCB-4363-s

Synonym(s): Gly-Val-Asp-Lys-Ala-Gly-Cys-Arg-Tyr-Met-Phe-Gly-Gly-Cys-Ser-Val-Asn-Asp-Asp-Cys-Cys-Pro-Arg-Leu-Gly-Cys-His-Ser-Leu-Phe-Ser-Tyr-Cys-Ala-Trp-Asp-Leu-Thr-Phe-Ser-Asp, Omega-theraphotoxin-Hg1a, SNX 482

One-Letter-Code: GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Disulfide Bonds: (Disulfide bonds between Cys7-Cys21, Cys14-Cys26, and Cys20-Cys33)

Application: Synthetic Product Class-E (R-Type) Ca2+ Channel Blocker

Description: Sequence originally derived from the Tarantula spider, Hysterocrates gigas. SNX-482 has also been found to have antinociceptive properties.; As well as being a Class-E (R-Type) Ca2+ channel blocker, it is a potent inhibitor of Kv4.3 channels and blocks sodium channels at higher concentrations.

CAS Number: 203460-30-4

Molecular Weight (g/mol): 4495

Storage Conditions: -20 °C

Reference(s): R. Newcomb, B. Szoke, A. Palma, G. Wang, X.-h. Chen, W. Hopkins, R. Cong, J. Miller, L. Urge, K. Tarczy-Hornoch, J.A. Loo, D.J. Dooley, L. Nadasdi, R.W. Tsien, J. Lemos, and G. Miljanich, Biochemistry, 37, 15353 (1998). (Original) L. Ürge, B. Szöke, D. Silva, P. Tran-N-tau, D. Hom, K. Tarczy-Hornoch, and L. Nádasdi, , Peptides 1998, Proceedings of 25<sup>th</sup> European Peptide Symposium (S. Bajusz and F. Hudecz, eds.), Akadémiai Kiadó Butapest, 748-749 (1998). (S-S Bond) A. Tottene, S. Volsen, and D. Pietrobon, J. Neurosci., 20, 171 (2000). (Pharmacol.); G. Wang, G. Dayanithi, R. Newcomb, and J.R. Lemos, J. Neurosci., 19, 9235 (1999). (Pharmacol.) D. Sochivko, A. Pereverzev, N. Smyth, C. Gissel, T. Schneider, and H. Beck, J. Physiol., 542, 699 (2002). (Pharmacol.) X. Jing, et al., J. Clin. Invest., 115, 146 (2005). (Pharmacol.) E.K. Johnson, et al., Circulation: Arrhythmia and Electrophysiology. 11, e005914 (2018). T. Kimm & B.P. Bean. Journal of Neuroscience, 34 (28), 9182 (2014). L. Xie et al., PLoS ONE, 11, e0147862 (2016).

Special Note(s): For research use ONLY. Not for use on humans.