alpha-Defensin-1 (Human) (0.1mg vial)

Product Name: alpha-Defensin-1 (Human) (0.1mg vial)

Product Number: PDF-4271-s

Synonym(s): Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys HNP-1 (HNP: Human Neutrophil Peptide), HNP-1, DEFA1, alpha-Defensin-1

One-Letter-Code: ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Disulfide Bonds: (Disulfide bonds are formed between Cys2-Cys30, Cys4-Cys19, and Cys9-Cys29)

Application: Antimicrobial Peptide / Chemoattractant for Monocytes

Molecular Weight (g/mol): 3442

Storage Conditions: -20 °C

Reference(s): T. Ganz, M.E. Selsted, D. Szklarek, S.S.L. Harwig, K. Daher, D.F. Bainton, and R.I. Lehrer, J. Clin. Invest., 76, 1427 (1985). (Original; Isolation) M.E. Selsted, S.S.L. Harwig, T. Ganz, J.W. Schilling, and R.I. Lehrer, J. Clin. Invest., 76, 1436 (1985). (Original; Structure) R.I. Lehrer and T. Ganz, Ann. N.Y. Acad. Sci., 797, 228 (1996). (Review)

Special Note(s): For research use ONLY. Not for use on humans.