beta-Defensin-1 (Human) (0.1mg vial)

Product Name: beta-Defensin-1 (Human) (0.1mg vial)

Product Number: PDF-4337-s

Synonym(s): hBD-1, Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys, DEFB1, beta-Defensin-1, BD-1

One-Letter-Code: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Disulfide Bonds: (Disulfide bonds between Cys5-Cys34, Cys12-Cys27, and Cys17-Cys35)

Application: Antimicrobial Peptide

Molecular Weight (g/mol): 3928.5

Storage Conditions: -20 °C

Reference(s): K.W. Bensch, M. Raida, H-J. Mägert, P. Schulz-Knappe, and W.-G. Forssmann, FEBS Lett., 368, 331 (1995). (Original) M.J. Goldman, G.M. Anderson, E.D. Stolzenberg, U.P. Kari, M. Zasloff, and J.M. Wilson, Cell, 88, 553 (1997). (Pharmacol.; Inactivated in Cystic Fibrosis) T. Hiratsuka, M. Nakazato, T. Ihi, T. Minematsu, N. Chino, T. Nakanishi, A. Shimizu, K. Kangawa, and S. Matsukura, Nephron, 85, 34 (2000). (Pharmacol.) R.I. Lehrer and T. Ganz, Ann. N.Y. Acad. Sci., 797, 228 (1996). (Review)

Special Note(s): For research use ONLY. Not for use on humans.