beta-Defensin-2 (Human) (0.1mg vial)

Product Name: beta-Defensin-2 (Human) (0.1mg vial)

Product Number: PDF-4338-s

Synonym(s): hBD-2, BD-2, Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro

One-Letter-Code: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Disulfide Bonds: (Disulfide bonds between Cys8-Cys37, Cys15-Cys28, and Cys20-Cys38)

Application: Antibacterial Peptide Specific for Gram-Negative Bacteria / Also Effective for Candida albicans

Molecular Weight (g/mol): 4328.2

Storage Conditions: -20 °C

Reference(s): J. Harder, J. Bartels, E. Christophers, and J.-M. Schroder, Nature, 387, 861 (1997). (Original) T. Hiratsuka, M. Nakazato, Y. Date, J. Ashitani, T. Minematsu, N. Chino, and S. Matsukura, Biochem. Biophys. Res. Commun., 249, 943 (1998). (Pharmacol.) D.M. Hoover, K.R. Rajashankar, R. Blumenthal, A. Puri, J.J. Oppenheim, O. Chertov, and J. Lubkowski, J. Biol. Chem., 275, 32911 (2000). (S-S Bond) T. Hiratsuka, H. Mukae, H. Iiboshi, J. Ashitani, K. Nabeshima, T. Minematsu, N. Chino, T. Ihi, S. Kohno, and M. Nakazato, Thorax, 58, 425 (2003). (Pharmacol.; Activity against Pseudomonas aeruginosa) R.I. Lehrer and T. Ganz, Ann. N.Y. Acad. Sci., 797, 228 (1996). (Review)

Special Note(s): For research use ONLY. Not for use on humans.