beta-Defensin-3 (Human) (0.1mg vial)

Product Name: beta-Defensin-3 (Human) (0.1mg vial)

Product Number: PDF-4382-s

Synonym(s): hBD-3, Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys, beta-Defensin-3, DEFB3, BD-3

One-Letter-Code: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Disulfide Bonds: (Disulfide bonds between Cys11-Cys40, Cys18-Cys33, and Cys23-Cys41)

Application: Antimicrobial Peptide / Staphylococcus aureus-Killing Factor

Molecular Weight (g/mol): 5155.1

Storage Conditions: -20 °C

Reference(s): J. Harder, J. Bartels, E. Christophers, and J.-M. Schröder, J. Biol. Chem., 276, 5707 (2001). (Original) J.-R.C. García, F. Jaumann, S. Schulz, A. Krause, J. Rodrínguez-Jiménez, U. Forssmann, K. Adermann, E. Klüver, C. Vogelmeier, D. Becker, R. Hedrich, W.-G. Forssmann, and R. Bals, Cell Tissue Res., 306, 257 (2001). (Original; Amino-Terminally Truncated Peptide) L.A. Duits, M. Rademaker, B. Ravensbergen, M.A.J.A. van Sterkenburg, E. van Strijen, P.S. Hiemstra, and P.H. Nibbering, Biochem. Biophys. Res. Commun., 280, 522 (2001). (Pharmacol.) H.P. Jia, B.C. Schutte, A. Schudy, R. Linzmeier, J.M. Guthmiller, G.K. Johnson, B.F. Tack, J.P. Mitros, A. Rosenthal, T. Ganz, and P.B. McCray, Jr., Gene, 263, 211 (2001). (DNA Seq/Tissue Distribution) D.J. Schibli, H.N. Hunter, V. Aseyev, T.D. Starner, J.M. Wiencek, P.B. McCray, Jr., B.F. Tack, and H.J. Vogel, J. Biol. Chem., 277, 8279 (2002). (Solution Structure) R.I. Lehrer and T. Ganz, Ann. N.Y. Acad. Sci., 797, 228 (1996). (Review)

Special Note(s): For research use ONLY. Not for use on humans.