Plectasin (0.1mg vial)

Product Name: Plectasin (0.1mg vial)

Product Number: PDF-4432-s

Synonym(s): Gly-Phe-Gly-Cys-Asn-Gly-Pro-Trp-Asp-Glu-Asp-Asp-Met-Gln-Cys-His-Asn-His-Cys-Lys-Ser-Ile-Lys-Gly-Tyr-Lys-Gly-Gly-Tyr-Cys-Ala-Lys-Gly-Gly-Phe-Val-Cys-Lys-Cys-Tyr

One-Letter-Code: GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY

Disulfide Bonds: (Disulfide bonds between Cys4-Cys30, Cys15-Cys37, and Cys19-Cys39)

Application: Antimicrobial Peptide

Source: Synthetic, sequence derived from Fungus, Pseudoplectania nigrella

Salt Form: Hydrochloride Form

Molecular Weight (g/mol): 4401.9

Storage Conditions: -20 °C

Reference(s): P.H. Mygind, et al., Nature, 437, 975 (2005). (Original ; Structure & Antimicrobial Activity) S. Hara, et al., Biochem. Biophys. Res. Commun., 374, 709 (2008). (Pharmacol.) K. Mandal, et al., Protein Sci., 18, 1146 (2009). (X-ray Structure) T. Schneider, et al., Science, 328, 1168 (2010). (Pharmacol.)

Special Note(s): For research use ONLY. Not for use on humans.