Product Name: Exendin-4

Product Number: PEX-3784-PI

Synonym(s): H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2, Exenatide

One-Letter-Code: H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Application: GLP-1 (Glucagon-Like Peptide-1) Receptor Agonist

Description: Synthetic peptide whose sequence was originally isolated from venom derived from the modified salivary glands of the Gila monster (Heloderma suspectum).

Salt Form: Trifluoroacetate salt

CAS Number: 141758-74-9

Molecular Weight (g/mol): 4186.66

Storage Conditions: -20 °C

Reference(s): R Göke, et al., J Biol Chem., 26, 19650 (1993). B. Thorens, et al., Diabetes, 42, 1678, (1993). A. Alcántara, et al., Arch Biochem Biophys., 341, 1, (1997).

Special Note(s): For research use ONLY. Not for use on humans.