Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)

Product Name: Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)

Product Number: PGL-3826-PI

Synonym(s): Preproglucagon (53-89), Proglucagon (33-69), OXM, H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-OH

One-Letter-Code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Application: Inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans.

Salt Form: Trifluoroacetate

CAS Number: 159002-68-3

Molecular Weight (g/mol): 4449.93

Storage Conditions: -20 °C

Special Note(s): For research use ONLY. Not for use on humans.