Glucagon-like Peptide 1 (Human, 7-36 Amide) (0.5 mg vial)
Product Name: Glucagon-like Peptide 1 (Human, 7-36 Amide) (0.5 mg vial)
Product Number: PGL-4344-v
Synonym(s): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2; GLP-1 (Human,(Bovine, Canine, Rat, Guinea pig, 7-36 Amide)
One-Letter-Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
CAS Number: 107444-51-9
Molecular Weight (g/mol): 3297.6
Storage Conditions: -20 °C
Reference(s): M.D. Turton, D. O'shea, I. Gunn, S.A. Beak, C.M.B. Edwards, K. Meeran, S.J. Choi, G.M. Taylor, M.M. Heath, P.D. Lambert, J.P.H. Wilding, D.M. Smith, M.A. Ghatei,J. Herbert, and S.R. Bloom, Nature, 379, 69 (1996). (Orginial-CNS Effect on Feeding) M. Tang-Christensen, P.J. Larsen, R. Göke, A. Fink-Jensen, D.S. Jessop, M. Møller, and S.P. Sheikh, Am. J. Physiol., 271, R848 (1996). (Original, CNS Effect on Drinking); E. Blázquez, E. Alvarez, M. Navarro, I. Roncero, F. Rodríguez-Fonseca, J.A. Chowen, and J.A. Zueco, Mol. Neurobiol., 18, 157 (1998). (Review) G. van Dijk and T.E. Thiele, Neuropeptides, 33, 406 (1999). (Review); D.J. Drucker, Gut, 50, 428 (2002). (Review) M.D. Turton, D. O'shea, I. Gunn, S.A. Beak, C.M.B. Edwards, K. Meeran, S.J. Choi, G.M. Taylor, M.M. Heath, P.D. Lambert, J.P.H. Wilding, D.M. Smith, M.A. Ghatei,J. Herbert, and S.R. Bloom, Nature, 379, 69 (1996). (Orginial-CNS Effect on Feeding) G. van Dijk, T.E. Thiele, R.J. Seeley, S.C. Woods, and I.L. Bernstein, Nature, 385, 214 (1997). (Correspondence)
Special Note(s): For research use ONLY. Not for use on humans.