Glucagon-like Peptide 2 (Human) (0.5 mg vial)
Product Name: Glucagon-like Peptide 2 (Human) (0.5 mg vial)
Product Number: PGL-4376-v
Synonym(s): H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-H-Thr-Lys-Ile-Thr-Asp-OH, GLP-2 (human)
One-Letter-Code: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
CAS Number: 223460-79-5
Molecular Weight (g/mol): 3766.1
Storage Conditions: -20 °C
Reference(s): D.J. Drucker, Gut, 50, 4289 (2002). (Review) B. Hartmann, A.H. Johnsen, C. Ørskov, K. Adelhorst, L. Thim, and J.J. Holst, Peptides, 21, 73 (2000). (Pharmacol.) M. Tang-Christensen, P.J. Larsen, J. Thulesen, J. Rømer, and N. Vrang, Nat. Med., 6, 802 (2000). (Pharmacol.) E. Blázquez, E. Alvarez, M. Navarro, I. Roncero, F. Rodríguez-Fonseca, J.A. Chowen, and J.A. Zueco, Mol. Neurobiol., 18, 157 (1998). (Review) G. van Dijk and T.E. Thiele, Neuropeptides, 33, 406 (1999). (Review); D.J. Drucker, Gut, 50, 428 (2002). (Review)
Special Note(s): For research use ONLY. Not for use on humans.