Galanin-like Peptide (Human, 1-60) (0.1mg vial)

Product Name: Galanin-like Peptide (Human, 1-60) (0.1mg vial)

Product Number: PGL-4391-s

Synonym(s): Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro-Pro-Gln-Pro-Ser, GALP (Human, 1-60)

One-Letter-Code: APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS

Application: Ligand for Galanin Receptor 2 / Target Peptide for Feeding Regulation by Leptin

Description: ;

Molecular Weight (g/mol): 6500.3

Storage Conditions: -20 °C

Reference(s): T. Ohtaki, S. Kumano, Y. Ishibashi, K. Ogi, H. Matsui, M. Harada, C. Kitada, T. Kurokawa, H. Onda, and M. Fujino, J. Biol. Chem., 274, 37041 (1999). (Original) Y. Matsumoto, T. Watanabe, Y. Adachi, T. Itoh, T. Ohtaki, H. Onda, T. Kurokawa, O. Nishimura, and M. Fujino, Neurosci. Lett., 322, 67 (2002). (Stimulation of Food Intake) A. Juréus, M.J. Cunningham, M.E. Mcclain, D.K. Clifton, and R.A. Steiner, Endocrinology, 141, 2703 (2000). (Pharmacol.) A.J. Kastin, V. Akerstrom, and L. Hackler, Neuroendocrinology, 74, 423 (2001). (Brain Entry); A.L. Gundlach, Eur. J. Pharmacol., 440, 255 (2002). (Review)

Special Note(s): For research use ONLY. Not for use on humans.