Glucagon-like Peptide 1 (Human 7-37) (0.5 mg vial)
Product Name: Glucagon-like Peptide 1 (Human 7-37) (0.5 mg vial)
Product Number: PGP-4280-v
Synonym(s): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly; GLP-1 (7-37) (Human, Bovine, Canine, Rat, Guinea pig)
One-Letter-Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
CAS Number: 106612-94-6
Molecular Weight (g/mol): 3355.7
Storage Conditions: -20 °C
Reference(s): G.G. Holz IV, W.M. Kühtreiber, and J.F. Habener, Nature, 361, 362 (1993). (Original) E. Blázquez, E. Alvarez, M. Navarro, I. Roncero, F. Rodríguez-Fonseca, J.A. Chowen, and J.A. Zueco, Mol. Neurobiol., 18, 157 (1998). (Review) G. van Dijk and T.E. Thiele, Neuropeptides, 33, 406 (1999). (Review); D.J. Drucker, Gut, 50, 428 (2002). (Review)
Special Note(s): For research use ONLY. Not for use on humans.