GIP (Human) (0.5 mg vial)

Product Name: GIP (Human) (0.5 mg vial)

Product Number: PGR-4178-v

Synonym(s): Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; Gastric Inhibitory Polypeptide (Human) Glucose-dependent Insulinotropia Polypeptide (Human)

One-Letter-Code: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

CAS Number: 100040-31-1

Molecular Weight (g/mol): 4983.5

Storage Conditions: -20 °C

Reference(s): A.J. Moody, L. Thim, and I. Valverde, FEBS Lett., 172, 142 (1984). (Original) N. Fujii, M. Sakurai, K. Akaji, M. Nomizu, H. Yajima, K. Mizuta, M. Aono, M. Moriga, K. Inoue, R. Hosotani, and T. Tobe, Chem. Pharm. Bull., 34, 2397 (1986). (Glucose-dependent Insulinotropic Polypeptide) J.E. Jorpes and V. Mutt (eds.) Secretin, Cholecystokinin, Pancreozymin and Gastrin, Handbook of Experimental Pharmacology, Vol. 34, Springer-Verlag, Berlin, 1973. (Review)

Special Note(s): For research use ONLY. Not for use on humans.