LL-37 ( Human) (0.1mg vial)

Product Name: LL-37 ( Human) (0.1mg vial)

Product Number: PLL-4445-s

Synonym(s): Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser, CAP-18, CAP18, LL37, LL-37, CRAMP, CAMP, Cathelicidin Antimicrobial Peptide

One-Letter-Code: [LL-37, 37 aa]

Application: Cathelicidin Antimicrobial Peptide

Description: LL-37 is a 37-amino acid peptide resulting from extracellular cleavage of the C-terminal end of the 18-kDa hCAP18 protein.

CAS Number: 154947-66-7

Molecular Weight (g/mol): 4493.3

Purity: ?98.0% (HPLC)

Storage Conditions: -20 °C

Reference(s): G.H. Gudmundsson, B. Agerberth, J. Odeberg, T. Bergman, B. Olsson, and R. Salcedo,Eur. J. Biochem., 238, 325 (1996). (Original) R. Bals and J.M. Wilson, Cell. Mol. Life Sci., 60, 711 (2003). (Review) R. Lande, J. Gregorio, V. Facchinetti, B. Chatterjee, Y.-H. Wang, B. Homey, W. Cao, Y.-H. Wang, B. Su, F.O. Nestle, T. Zal, I. Mellman, J.-M. Schröder, Y.-J. Liu, and M. Gilliet, Nature, 449, 564 (2007). (Pharmacol.) M. Zanetti, J. Leukoc. Biol., 75, 39 (2004). (Review) P.T. Liu, S. Stenger, H. Li, L.Wenzel, B.H. Tan, S.R. Krutzik, M.T. Ochoa, J. Schauber, K. Wu, C. Meinken, D.L. Kamen, M. Wagner, R. Bals, A. Steinmeyer, U. Zügel, R.L. Gallo, D. Eisenberg, M. Hewison, B.W. Hollis, J.S. Adams, B.R. Bloom, and R., Science, 311, 1770 (2006). (Pharmacol.) P.Y. Ong, T. Ohtake, C. Brandt, I. Strickland, M. Boguniewicz, T. Ganz, R.L. Gallo, and, D.Y.M. Leung, N. Engl. J. Med., 347, 1151 (2002). (Pharmacol.) D.W. Hoskin and A. Ramamoorthy, Biochim. Biophys. Acta, 1778, 357 (2008). (LL-37 Review) Y. Lai and R.L. Gallo, Trends Immunol., 30, 131 (2009). (Review) M.F. Burton and P.G. Steel, Nat. Prod. Rep., 26, 1572 (2009). (Review)

Special Note(s): For research use ONLY. Not for use on humans.