Liver-Expressed Antimicrobial Peptide 2 (Human) (0.1mg vial)

Product Name: Liver-Expressed Antimicrobial Peptide 2 (Human) (0.1mg vial)

Product Number: PLP-4405-s

Synonym(s): Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu, LEAP-2 (Human, Mouse), Prepro-LEAP-2 (Human, 38-77), (Mouse 37-76)

One-Letter-Code: MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE

Disulfide Bonds: (Disulfide bonds between Cys17-Cys28 and Cys23-Cys33)

Application: Antimicrobial Peptide

Molecular Weight (g/mol): 4581.3

Storage Conditions: -20 °C

Reference(s): A. Krause, R. Sillard, B. Kleemeier, E. Klüver, E. Maronde, J.R. Conejo-García, W.G. Forssmann, P. Schulz-Knappe, M.C. Nehls, F. Wattler, S. Wattler, and K. Adermann, Protein Sci., 12, 143 (2003). (Original & S-S Bond)

Special Note(s): For research use ONLY. Not for use on humans.