Midkine (Human, 60-121) (0.1mg vial)
Product Name: Midkine (Human, 60-121) (0.1mg vial)
Product Number: PMK-4299-s
Synonym(s): Ala-Asp-Cys-Lys-Tyr-Lys-Phe-Glu-Asn-Trp-Gly-Ala-Cys-Asp-Gly-Gly-Thr-Gly-Thr-Lys-Val-Arg-Gln-Gly-Thr-Leu-Lys-Lys-Ala-Arg-Tyr-Asn-Ala-Gln-Cys-Gln-Glu-Thr-Ile-Arg-Val-Thr-Lys-Pro-Cys-Thr-Pro-Lys-Thr-Lys-Ala-Lys-Ala-Lys-Ala-Lys-Lys-Gly-Lys-Gly-Lys-Asp
One-Letter-Code: ADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Disulfide Bonds: (Disulfide bonds between Cys62-Cys94 and Cys72-Cys104)
Application: Heparin-Binding Growth/Differentiation Factor Active-Domain (Neurite Outgrowth-Promoting Factor) Plasminogen Activator Activity Enhancer
Molecular Weight (g/mol): 6788.8
Storage Conditions: -20 °C
Reference(s): H. Muramatsu, T. Inui, T. Kimura, S. Sakakibara, X.-J. Song, H. Maruta, and T. Muramamtsu, Biochem. Biophys. Res. Commun., 203, 1131 (1994) J.-i. Tsutsui, K. Uehara, K. Kadomatsu, S. Matsubara, and T. Muramatsu, Biochem. Biophys. Res. Commun., 176, 792 (1991). (Original) T. Inui, J. Bangstrom³di, S. Kubo, H. Nishio, T. Kimura, S. Kojima, H. Maruta, T. Muramatsu, and S. Sakakibara, J. Peptide Sci., 2, 28 (1996). (Chem. Synthesis) G.S.P. Yu, J. Hu, and H. Nakagawa, Neurosci. Lett., 254, 128 (1998). (Pharmacol.; Inhibition of beta-amyloid cytotoxicity)
Special Note(s): For research use ONLY. Not for use on humans.