Neuromedin U Precursor-Related Peptide 36 (Rat, Mouse) (0.1 mg vial)

Product Name: Neuromedin U Precursor-Related Peptide 36 (Rat, Mouse) (0.1 mg vial)

Product Number: PNM-4506-s

Synonym(s): NURP36 (Rat, Mouse); Phe-Leu-Phe-His-Tyr-Ser-Lys-Thr-Gln-Lys-Leu-Gly-Asn-Ser-Asn-Val-Val-Ser-Ser-Val-Val-His-Pro-Leu-Leu-Gln-Leu-Val-Pro-Gln-Leu-His-Glu-Arg-Arg-Met

One-Letter-Code: FLFHYSKTQKLGNSNVVSSVVHPLLQLVPQLHERRM

Application: Endogenous Peptide Produced From Neuromedin U Precursor / Possible Regulator of Prolactin Release

Source: Rat, Mouse

CAS Number: 894454-40-1

Molecular Weight (g/mol): 4203.9

Purity: ?97.0% (HPLC)

Storage Conditions: -20 °C

Reference(s): K. Mori, T. Ida, M. Fudetani, M. Mori, H. Kaiya, J. Hino, K. Nakahara, N. Murakami, M. Miyazato, and K. Kangawa, Sci. Rep., 7, 10468 (2017). (Original) T. Ensho, K. Maruyama, K. Mori, M. Miyazato, K. Kangawa, K. Nakahara, and N. Murakami, Biochem. Biophys. Res. Commun., 492, 412 (2017). (Pharmacol.)

Special Note(s): For research use ONLY. Not for use on humans.