Neuromedin S Precursor-Related Peptide 37 (Rat) (0.1 mg vial)

Product Name: Neuromedin S Precursor-Related Peptide 37 (Rat) (0.1 mg vial)

Product Number: PNM-4507-s

Synonym(s): NSRP37 (Rat); Phe-Leu-Phe-His-Tyr-Ser-Arg-Ala-Trp-Lys-Ser-Thr-His-Pro-Val-Asn-Ser-Glu-Phe-Ala-Pro-Val-His-Pro-Leu-Met-Arg-Leu-Ala-Ala-Lys-Leu-Pro-Ser-Arg-Arg-Met

One-Letter-Code: FLFHYSRAWKSTHPVNSEFAPVHPLMRLAAKLPSRRM

Source: Rat

CAS Number: 894454-13-8

Molecular Weight (g/mol): 4380.1

Purity: ?98.0% (HPLC)

Storage Conditions: -20 °C

Reference(s): K. Mori, T. Ida, M. Fudetani, M. Mori, H. Kaiya, J. Hino, K. Nakahara, N. Murakami, M. Miyazato, and K. Kangawa, Sci. Rep., 7, 10468 (2017). (Original)

Special Note(s): For research use ONLY. Not for use on humans.