Nocistatin (Human) (0.5 mg vial)

Product Name: Nocistatin (Human) (0.5 mg vial)

Product Number: PNO-4355-v

Synonym(s): Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln

One-Letter-Code: MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ

Application: Endogenous Allodynia / Hyperalgesia-Blocking Peptide Nociceptin Action Blocking Peptide

CAS Number: 212609-11-5

Molecular Weight (g/mol): 3561.9

Storage Conditions: -20 °C

Reference(s): T. Minami, E. Okuda-Ashitaka, Y. Nishiuchi, T. Kimura, S. Tachibana, H. Mori, and S. Ito, Br. J. Pharmacol., 124, 1016 (1998). (Original; Pharmacol.) C. Mollereau, M.-J. Simons, P. Soularue, F. Liners, G. Vassart, J.-C. Meunier, and M. Parmentier, Proc. Natl. Acad. Sci. U.S.A., 93, 8666 (1996). (Original; Prepronociceptin Nucleotide Seq.) T.-L. Lee, F.M.Y. Fung, F.-G. Chen, N. Chou, E. Okuda-Ashitaka, S. Ito, Y. Nishiuchi, T. Kimura, and S. Tachibana, NeuroReport, 10,1537 (1999). (Original; Identification in Human)

Special Note(s): For research use ONLY. Not for use on humans.