Neuropeptide W-30 (Human) (0.5 mg vial)

Product Name: Neuropeptide W-30 (Human) (0.5 mg vial)

Product Number: PNP-4403-v

Synonym(s): Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp, NPW30 (Human), hL8C

One-Letter-Code: WYKHVASPRYHTVGRAAGLLMGLRRSPYLW

Application: Food Intake-Regulating Peptide / GPR7 / GPR8 Ligand

CAS Number: 383415-80-3

Molecular Weight (g/mol): 3543.1

Storage Conditions: -20 °C

Special Note(s): For research use ONLY. Not for use on humans.