PACAP38 (Human) (0.5 mg vial)

Product Name: PACAP38 (Human) (0.5 mg vial)

Product Number: PPA-4221-v

Synonym(s): His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2, Pituitary Adenylate Cyclase Activating Polypeptide 38 (Human, Ovine, Rat, 1-38 Amide), PACAP-38

One-Letter-Code: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

Application: Pituitary Adenylate Cyclase Activating Polypeptide 38 (Human)

CAS Number: 124123-15-5

Molecular Weight (g/mol): 4534.3

Storage Conditions: -20 °C

Reference(s): A. Miyata, A. Arimura, R.R. Dahl, N. Minamino, A. Uehara, L. Jiang, M.D. Culler, and D.H. Coy, Biochem Biophys. Res. Commun., 164, 567 (1989). (Original)

Special Note(s): For research use ONLY. Not for use on humans.