PACAP27 (Human, 1-27 Amide) (0.5 mg vial)
Product Name: PACAP27 (Human, 1-27 Amide) (0.5 mg vial)
Product Number: PPA-4231-v
Synonym(s): His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2, Pituitary Adenylate Cyclase Activating Polypeptide 27 (Human,Ovine, Rat, 1-27 Amide), PACAP-27
One-Letter-Code: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Application: Pituitary Adenylate Cyclase Activating Polypeptide 27 (Human, 1-27 Amide)
CAS Number: 127317-03-7
Molecular Weight (g/mol): 3147.6
Storage Conditions: -20 °C
Reference(s): A. Miyata, L. Jiang, R.D. Dahl, C. Kitada, K. Kubo, M. Fujino, N. Minamino, and A. Arimura, Biochem. Biophys. Res. Commun., 170, 643 (1990). (Original) C. Kimura, S. Ohkubo, K. Ogi, M. Hosoya, Y. Itoh, H. Onda, A. Miyata, L. Jiang, R.R. Dahl, H.H. Stibbs, A. Arimura, and M. Fujino, Biochem. Biophys. Res. Commun., 166, 81 (1990). (Original; Human and Bovine cDNA) K. Ogi, C. Kimura, H. Onda, A. Arimura, and M. Fujino, Biochem. Biophys. Res. Commun., 173, 1271 (1990). (Original: Rat cDNA)
Special Note(s): For research use ONLY. Not for use on humans.