PHM-27 (Human) (0.5 mg vial)
Product Name: PHM-27 (Human) (0.5 mg vial)
Product Number: PPM-4177-v
Synonym(s): His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-NH2, Peptide Histidine-Methionine
One-Letter-Code: HADGVFTSDFSKLLGQLSAKKYLESLM-NH2
Description: A potent agonist of the calcitonin receptor CALCR
CAS Number: 87403-73-4
Molecular Weight (g/mol): 2985.4
Storage Conditions: -20 °C
Reference(s): N. Itoh, K. Obata, N. Yanaihara, and H. Okamoto, Nature, 304, 547 (1983). (Original)
Special Note(s): For research use ONLY. Not for use on humans.