PHM-27 (Human) (0.5 mg vial)

Product Name: PHM-27 (Human) (0.5 mg vial)

Product Number: PPM-4177-v

Synonym(s): His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-NH2, Peptide Histidine-Methionine

One-Letter-Code: HADGVFTSDFSKLLGQLSAKKYLESLM-NH2

Description: A potent agonist of the calcitonin receptor CALCR

CAS Number: 87403-73-4

Molecular Weight (g/mol): 2985.4

Storage Conditions: -20 °C

Reference(s): N. Itoh, K. Obata, N. Yanaihara, and H. Okamoto, Nature, 304, 547 (1983). (Original)

Special Note(s): For research use ONLY. Not for use on humans.