RFamide-Related Peptide-1 (Human) (0.1mg vial)

Product Name: RFamide-Related Peptide-1 (Human) (0.1mg vial)

Product Number: PRF-4380-s

Synonym(s): Ser-Leu-Asn-Phe-Glu-Glu-Leu-Lys-Asp-Trp-Gly-Pro-Lys-Asn-Val-Ile-Lys-Met-Ser-Thr-Pro-Ala-Val-Asn-Lys-Met-Pro-His-Ser-Phe-Ala-Asn-Leu-Pro-Leu-Arg-Phe-NH2

One-Letter-Code: H-SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2

Application: Prolactin Secreting Peptide

Molecular Weight (g/mol): 4256.9

Storage Conditions: -20 °C

Reference(s): D.A. Price and M.J. Greenberg, Science, 197, 670 (1977). (Original: FMRF-Amide) S. Fukusumi, Y. Habata, H. Yoshida, N. Iijima, Y. Kawamata, M. Hosoya, R. Fujii, S. Hinuma, C. Kitada, Y. Shintani, M. Suenaga, H. Onda, O. Nishimura, M. Tanaka, Y. Ibata, and M. Fujino, Biochim. Biophys. Acta, 1540, 221 (2001). (Endogenous Form) S. Hinuma, Y. Shintani, S. Fukusumi, N. Iijima, Y. Matsumoto, M. Hosoya, R. Fujii, T. Watanabe, K. Kikuchi, Y. Terao, T. Yano, T. Yamamoto, Y. Kawamata, Y. Habata, M. Asada, C. Kitada, T. Kurokawa, H. Onda, O. Nishimura, M. Tanaka, Y. Ibata, and M. Fujino, Nat. Cell Biol., 2, 703 (2000). (Original: cDNA & Pharmacol. of RFRP-1) Q. Liu, X.-M. Guan, W.J. Martin, T.P. McDonald, M.K. Clements, Q. Jiang, Z. Zeng, M. Jacobson, D.L. Williams, Jr., H. Yu, D. Bomford, D. Figueroa, J. Mallee, R. Wang, J. Evans, R. Gould, and C.P. Austin, J. Biol. Chem., 276, 36961 (2001). (Original: NPSF)

Special Note(s): For research use ONLY. Not for use on humans.