Product Name: HMGB1 Human

Product No: PRO-581

Synonym(s): High-Mobility Group Box 1 Human Recombinant, HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1.

One-Letter-Code: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERW KTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLK EKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEED EDEEEDDDDELEHHHHHH

Description: HMG1 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa.The HMGB-1 is purified by proprietary chromatographic techniques.

Protein Derived From: Escherichia Coli.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Stability: Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized HMGB1 in sterile 18MOmega-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

References: 1.Title:High-Mobility Group Box 1 Mediates Epithelial-to-Mesenchymal Transition in Pulmonary Fibrosis Involving Transforming Growth Factor-b1/Smad2/3 SignalingPublication:Department of Pharmacy, Sir Run Run Shaw Hospital, School of Medicine, Zhejiang University, Hangzhou, People’s Republic of China (L.-C.L.); The First Affiliated Hospital of Anhui Medical University, Hefei, People’s Republic of China (D.-L.L., J.G.); School of Pharmacy, Anhui Medical University, Hefei, People’s Republic of China (X.-T.M., W.-H.C., W.-C.Z., J.L.); and School of Pharmacy, Anhui University of Chinese Medicine, Hefei, People’s Republic of China (D.-L.L., L.X., P.Z.).Link:http://jpet.aspetjournals.org/content/jpet/354/3/302.full.pdf

Special Note(s): Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.