Parathyroid Hormone (Human, 1-34) (0.1mg vial)

Product Name: Parathyroid Hormone (Human, 1-34) (0.1mg vial)

Product Number: PTH-4068-s

Synonym(s): Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe, Teriparatide (synthetic)

One-Letter-Code: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Application: Effective Anabolic Agent Used in the Treatment of Some Forms of Osteoporosis

CAS Number: 52232-67-4

Molecular Weight (g/mol): 4117.7

Storage Conditions: -20 °C

Reference(s): M. Takai, Y. Kurano, T. Kimura, and S. Sakakibara, Peptide Chemistry 1979, 187 (1980). (Chem. Synthesis)

Special Note(s): For research use ONLY. Not for use on humans.