TIP39 (Human, Bovine) (0.1mg vial)
Product Name: TIP39 (Human, Bovine) (0.1mg vial)
Product Number: PTH-4479-s
Synonym(s): Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro, Tuberoinfundibular Peptide 39, TIP 7-39, TIP 39
One-Letter-Code: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Application: Ligand for Parathyroid Hormone 2 Receptor
Molecular Weight (g/mol): 4504.2
Purity: ?99.0% including Met(O) analog (?1.0%) (HPLC)
Storage Conditions: -20 °C
Reference(s): M.R. John, M. Arai, D.A. Rubin, K.B. Jonsson, and H.Jüppner, Endocrinology, 143, 1047 (2002). (Original) L. Coutellier and T.B. Usdin, Behav. Brain Res., 222, 265 (2011). (Pharmacol.) E.L. Dimitrov, J. Kuo, K. Kohno, and T.B. Usdin, Proc. Natl. Acad. Sci. U.S.A., 110, 13156 (2013). (Pharmacol.) A. Dobolyi, M. Palkovits, and T.B. Usdin, Prog. Neurobiol., 90, 29 (2010). (Review) J Pharm Pharmacol. (2019) Mar 5. doi: 10.1111/jphp.13085. [Epub ahead of print]
Special Note(s): For research use ONLY. Not for use on humans.