ProTx-I (0.1mg vial)
Product Name: ProTx-I (0.1mg vial)
Product Number: PTX-4409-s
Synonym(s): Glu-Cys-Arg-Tyr-Trp-Leu-Gly-Gly-Cys-Ser-Ala-Gly-Gln-Thr-Cys-Cys-Lys-His-Leu-Val-Cys-Ser-Arg-Arg-His-Gly-Trp-Cys-Val-Trp-Asp-Gly-Thr-Phe-Ser, ProTx1
One-Letter-Code: ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS
Disulfide Bonds: (Disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15- Cys28)
Application: Synthetic Product T-Type Ca2+ Channel / Na+ Channel / K+ Ion Channel Blocker (Gating Modifier)
Description: A spider venom-peptide whose sequence is derived from the Tarantula,; Thrixopelma pruriens.
Molecular Weight (g/mol): 3987.5
Storage Conditions: -20 °C
Reference(s): R.E. Middleton, V.A. Warren, R.L. Kraus, J.C. Hwang, C.J. Liu, G. Dai, R.M. Brochu, M.G. Kohler, Y.D. Gao, V.M. Garsky, M.J. Bogusky, J.T. Mehl, C.J. Cohen, and M.M. Smith, Biochemistry, 41, 14734 (2002). (Original) T. Ohkubo, J. Yamazaki, and K. Kitamura, J. Pharmacol. Sci., 112, 452 (2010). (Pharmacol.) B.T. Priest, K.M. Blumenthal, J.J. Smith, V.A. Warren, and M.M. Smith, Toxicon, 49, 194 (2007). (Review)
Special Note(s): For research use ONLY. Not for use on humans.