VIP (Human, Porcine) (0.5 mg vial)

Product Name: VIP (Human, Porcine) (0.5 mg vial)

Product Number: PVA-4110-v

Synonym(s): His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg- Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2

One-Letter-Code: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2

Application: Vasoactive Intestinal Peptide (Human, Porcine, Bovine, Rat, Canine)

CAS Number: 40077-57-4

Molecular Weight (g/mol): 3325.8

Storage Conditions: -20 °C

Reference(s): V. Mutt and S.I. Said, Eur. J. Biochem., 42, 581 (1974). (Original; Porcine) N. Itoh, K. Obata, N. Yanaihara, and H. Okamoto, Nature, 304, 547 (1983). (cDNA Seq.; Human) R. Dimaline, J.R. Reeve, Jr., J.E. Shively, and D. Hawke, Peptides, 5, 183 (1984). (Original; Rat) S.C. Wang, B.H. Du, J. Eng, M. Chang, J.D. Hulmes, Y.-C.E. Pan, and R.S. Yalow, Life Sci., 37, 979 (1985). (Original; Canine)

Special Note(s): For research use ONLY. Not for use on humans.