Teduglutide
Product Name: Teduglutide
Product Number: TED-3880-PI
Synonym(s): H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH, [Gly2]-GLP-2 (human)
One-Letter-Code: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Application: Glucagon-like Peptide-2 Analog Used to Treat Short Bowel Syndrome
Description: Bolar Exemption applies.; This is a FDA-regulated product. It is the responsibility of the customer to ensure that they are complying with Federal rules. PI cannot be liable for infringement of rights made by the user.
Salt Form: Trifluoroacetate
CAS Number: 197922-42-2
Molecular Weight (g/mol): 3752.16
Storage Conditions: -20 °C
Reference(s): Jeppesen, P., et al.: Gut, 54, 1224 (2005). Jeppesen, P.B., Therap. Adv. Gastroenterol., 5,159 (2012). D. J. Drucker et al., American Journal of Physiology - Gastrointestinal and Liver Physiology, 276(1), G79 (1999).
Special Note(s): For research use ONLY. Not for use on humans.